Beta-lactamase TEM, Recombinant, E. coli, aa24-286, His-SUMO-Tag (Bla)
Biozol Catalog Number:
USB-370541
Supplier Catalog Number:
370541
Alternative Catalog Number:
USB-370541-20,USB-370541-100,USB-370541-1
Manufacturer:
US Biological
Category:
Molekularbiologie
T-type are the most prevalent beta-lactamases in enterobacteria, they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. T-3 and T-4 are capable of hydrolyzing cefotaxime and ceftazidime. T-5 is capable of hydrolyzing ceftazidime. T-6 is capable of hydrolyzing ceftazidime and aztreonam. T-8/CAZ-2, T-16/CAZ-7 and T-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors. Full length recombinant protein corresponding to aa24-286 from mature Escherichia coli Beta-lactamase TEM, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P62593. Molecular Weight: ~44.89kD Amino Acid Sequence: HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
