Bone Sialoprotein 2, Recombinant, Human, aa129-281, His-SUMO-Tag (IBSP)
Biozol Catalog Number:
USB-370545
Supplier Catalog Number:
370545
Alternative Catalog Number:
USB-370545-20,USB-370545-100,USB-370545-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment. Source: Partial recombinant protein corresponding to aa129-281 from human IBSP, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.4kD Amino Acid Sequence: AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted