CRMP1, Recombinant, Human, aa1-572, His-SUMO-Tag (Dihydropyrimidinase-related Protein 1, Collapsin Response Mediator Protein 1)

Catalog Number: USB-370572
Article Name: CRMP1, Recombinant, Human, aa1-572, His-SUMO-Tag (Dihydropyrimidinase-related Protein 1, Collapsin Response Mediator Protein 1)
Biozol Catalog Number: USB-370572
Supplier Catalog Number: 370572
Alternative Catalog Number: USB-370572-20,USB-370572-100,USB-370572-1
Manufacturer: US Biological
Category: Molekularbiologie
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. May participate in cytokinesis. Full length recombinant protein corresponding to aa1-572 from human CRMP1, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Accession/Uniprot: Q14194 Molecular Weight: ~78.1kD Amino Acid Sequence: MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 78.1
UniProt: Q14194
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid Tris, 50% glycerol.