Defensin-like Protein 1, Recombinant, Dahlia Merckii, aa1-50, 6xHis-B2M-Tag

Product Overview

• Article Name: Defensin-like Protein 1, Recombinant, Dahlia Merckii, aa1-50, 6xHis-B2M-Tag
• Biozol Catalog Number: USB-370585
• Supplier Catalog Number: 370585
• Alternative Catalog Number: USB-370585-20,USB-370585-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes. Source: Recombinant protein corresponding to aa1-50 from full length Dahlia merckii Defensin-like protein 1, fused to 6xHis-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.5kD Amino Acid Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 19.5
• UniProt: P0C8Y4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.