Enterotoxin Type G, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (EntG, SEG)

Product Overview

• Article Name: Enterotoxin Type G, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (EntG, SEG)
• Biozol Catalog Number: USB-370602
• Supplier Catalog Number: 370602
• Alternative Catalog Number: USB-370602-20,USB-370602-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Recombinant protein corresponding to aa26-258 from Staphylococcus aureus Enterotoxin type G, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.02kD Amino Acid Sequence: QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43.02
• UniProt: P0A0L7
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.