Erythropoietin, Recombinant, Porcine, aa27-194, His-Tag (EPO)

Catalog Number: USB-370604
Article Name: Erythropoietin, Recombinant, Porcine, aa27-194, His-Tag (EPO)
Biozol Catalog Number: USB-370604
Supplier Catalog Number: 370604
Alternative Catalog Number: USB-370604-20,USB-370604-100
Manufacturer: US Biological
Category: Molekularbiologie
Erythropoietin is the principle hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Source: Recombinant protein corresponding to aa27-194 from porcine EPO, fused to 6xHis-Tag at N-terminal, expressed in yeast. Molecular Weight: ~20.6kD Amino Acid Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.6
UniProt: P49157
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.