ESAT-6-like Protein EsxH, Recombinant, Mycobacterium Tuberculosis, aa2-96, His-SUMO-Tag (EsxH, CFP-7)

Product Overview

• Article Name: ESAT-6-like Protein EsxH, Recombinant, Mycobacterium Tuberculosis, aa2-96, His-SUMO-Tag (EsxH, CFP-7)
• Biozol Catalog Number: USB-370605
• Supplier Catalog Number: 370605
• Alternative Catalog Number: USB-370605-20,USB-370605-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Partial recombinant protein corresponding to aa2-96 from Mycobacterium tuberculosis esxH, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.25kD Amino Acid Sequence: SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.25
• UniProt: P9WNK2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.