FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)

Product Overview

• Article Name: FCRL6, Recombinant, Human, aa20-307, His-Tag (Fc Receptor-like Protein 6)
• Biozol Catalog Number: USB-370610
• Supplier Catalog Number: 370610
• Alternative Catalog Number: USB-370610-20,USB-370610-100,USB-370610-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Partial recombinant protein corresponding to aa20-307 from human FCRL6, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot Accession: Q6DN72 Molecular Weight: ~35.8kD Amino Acid Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 35.8
• UniProt: Q6DN72
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.