GhrA, Recombinant, E. coli, aa1-312, His-SUMO-Tag (Glyoxylate/hydroxypyruvate Reductase A, 2-ketoacid Reductase)

Product Overview

• Article Name: GhrA, Recombinant, E. coli, aa1-312, His-SUMO-Tag (Glyoxylate/hydroxypyruvate Reductase A, 2-ketoacid Reductase)
• Biozol Catalog Number: USB-370623
• Supplier Catalog Number: 370623
• Alternative Catalog Number: USB-370623-20,USB-370623-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively. Source: Recombinant protein corresponding to aa1-312 from full length E. coli GhrA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.4kD Amino Acid Sequence: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 51.4
• UniProt: B7LFE3
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.