Granzyme A, Recombinant, Mouse, aa29-260, His-B2M-Tag (Gzma)
Biozol Catalog Number:
USB-370636
Supplier Catalog Number:
370636
Alternative Catalog Number:
USB-370636-20,USB-370636-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after Lys-31 and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after Lys-189, which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity). Source: Recombinant protein corresponding to aa29-260 from mouse Gzma, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD Amino Acid Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.