HupA, Recombinant, E. Coli, aa1-90, His-SUMO-Tag (DNA-binding Protein HU-alpha)

Product Overview

• Article Name: HupA, Recombinant, E. Coli, aa1-90, His-SUMO-Tag (DNA-binding Protein HU-alpha)
• Biozol Catalog Number: USB-370650
• Supplier Catalog Number: 370650
• Alternative Catalog Number: USB-370650-20,USB-370650-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. Source: Recombinant protein corresponding to aa1-90 from full length E. coli hupA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.53kD Amino Acid Sequence: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 25.53
• UniProt: P0ACF2
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.