Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-Tag (Mpt64)

Product Overview

• Article Name: Immunogenic Protein MPT64, Recombinant, Mycobacterium Tuberculosis, aa24-228, His-Tag (Mpt64)
• Biozol Catalog Number: USB-370659
• Supplier Catalog Number: 370659
• Alternative Catalog Number: USB-370659-20,USB-370659-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Recombinant protein corresponding to aa24-228 from mycobacterium tuberculosis Mpt64, fused to 6X His-Tag at N-terminal, expressed in yeast. Molecular Weight: ~24.4kD Amino Acid Sequence: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 24.4
• UniProt: P9WIN8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.