Interleukin-4, Recombinant, Sheep, aa25-135, His-B2M-Tag, Myc-Tag (IL4)

Catalog Number: USB-370666
Article Name: Interleukin-4, Recombinant, Sheep, aa25-135, His-B2M-Tag, Myc-Tag (IL4)
Biozol Catalog Number: USB-370666
Supplier Catalog Number: 370666
Alternative Catalog Number: USB-370666-20,USB-370666-100
Manufacturer: US Biological
Category: Molekularbiologie
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Source: Recombinant protein corresponding to aa25-135 from sheep IL4, fused to 10XHis-B2M-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~29.6kD Amino Acid Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.6
UniProt: P30368
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.