Intimin, Recombinant, Hafnia Alvei, aa1-280, His-SUMO-Tag (EaeA)

Catalog Number: USB-370668
Article Name: Intimin, Recombinant, Hafnia Alvei, aa1-280, His-SUMO-Tag (EaeA)
Biozol Catalog Number: USB-370668
Supplier Catalog Number: 370668
Alternative Catalog Number: USB-370668-20,USB-370668-100
Manufacturer: US Biological
Category: Molekularbiologie
Necessary for the production of attaching and effacing lesions on tissue culture cells. Source: Recombinant protein corresponding to aa1-280 from full length Hafnia alvei Intimin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.1kD Amino Acid Sequence: ITEIKADKTTAVANGKDAVTYTVKVMKDGKPLSGEEVTFTTTLGTLSKSTEKTNTNGYRKVSLTSANQGKSLVSASVTMPQLMLKLLEVEFFTQLTIDNGNVEIVGTGAKGKLPNVWLQYGQVNLKANGGNGKYTWYSANPAIASVDPSSGQVTLKDKGETTITVVSGDKQTAIYTIAMPNSIVSVNSSGRVDYNTANNICKNIKGSLPSSIKELKDLYDDWGAANKYQHYSQESITAWTLQTSENKVQGVASTYDLVRKNPLIDKVDIAGNYAYAVCVK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.1
UniProt: P52869
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.