Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B/Serotype 15, aa20-331, His-Tag (PorB)

Catalog Number: USB-370685
Article Name: Major Outer Membrane Protein P.IB, Recombinant, Neisseria Meningitidis Serogroup B/Serotype 15, aa20-331, His-Tag (PorB)
Biozol Catalog Number: USB-370685
Supplier Catalog Number: 370685
Alternative Catalog Number: USB-370685-20,USB-370685-100
Manufacturer: US Biological
Category: Molekularbiologie
Serves as a slightly cation selective porin. Source: Recombinant protein corresponding to aa20-331 from Neisseria meningitidis serogroup B / serotype 15 porB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.8kD Amino Acid Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 49.8
UniProt: E6MZM0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.