OmcB, Recombinant, Chlamydia Trachomatis, aa41-196, His-SUMO-Tag (Large Cysteine-rich Periplasmic Protein OmcB)

Catalog Number: USB-370723
Article Name: OmcB, Recombinant, Chlamydia Trachomatis, aa41-196, His-SUMO-Tag (Large Cysteine-rich Periplasmic Protein OmcB)
Biozol Catalog Number: USB-370723
Supplier Catalog Number: 370723
Alternative Catalog Number: USB-370723-20,USB-370723-100
Manufacturer: US Biological
Category: Molekularbiologie
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane protein. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). Source: Partial recombinant protein corresponding to aa41-196 from Chlamydia trachomatis omcB, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.1kD Amino Acid Sequence: LADTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYATVGSPYPIEITATGKRDCVDVIITQQLPCEAEFVRSDPATTPTADGKLVWKIDRLGQGEKSKITVWVKPLKEGCCFTAATVCA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 33.1
UniProt: P0CC04
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.