Osteocalcin, Recombinant, Rat, aa50-99, GST-Tag (Bglap)

Product Overview

• Article Name: Osteocalcin, Recombinant, Rat, aa50-99, GST-Tag (Bglap)
• Biozol Catalog Number: USB-370728
• Supplier Catalog Number: 370728
• Alternative Catalog Number: USB-370728-20,USB-370728-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD Amino Acid Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 33
• UniProt: P04640
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.