Outer Membrane Protein C, Recombinant, Escherichia coli, aa22-367, His-SUMO-Tag (OmpC)
Biozol Catalog Number:
USB-370730
Supplier Catalog Number:
370730
Alternative Catalog Number:
USB-370730-20,USB-370730-100,USB-370730-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Forms pores that allow passive diffusion of small molecules across the outer membrane. Recombinant protein corresponding to aa22-367 from Escherichia coli Outer Membrane Protein C, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.28kD Amino Acid Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
