Papain, Recombinant, Carica Papaya, aa134-345, His-Tag (Papaya Proteinase I, PPI)

Product Overview

• Article Name: Papain, Recombinant, Carica Papaya, aa134-345, His-Tag (Papaya Proteinase I, PPI)
• Biozol Catalog Number: USB-370734
• Supplier Catalog Number: 370734
• Alternative Catalog Number: USB-370734-20,USB-370734-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Hydrolysis of proteins with broad specificity for peptide bonds, but preference for an amino acid bearing a large hydrophobic side chain at the P2 position. Does not accept Val in P1. Source: Recombinant protein corresponding to aa134-345 from Carica papaya Papain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.4kD Amino Acid Sequence: IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 27.4
• UniProt: P00784
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.