PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3)

Product Overview

• Article Name: PbpC, Recombinant, Bacillus Subtilis, aa21-240, His-Tag (Penicillin-binding Protein 3)
• Biozol Catalog Number: USB-370736
• Supplier Catalog Number: 370736
• Alternative Catalog Number: USB-370736-20,USB-370736-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Source: Partial recombinant protein corresponding to aa21-240 from Bacillus subtilis PbpC, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.2kD Amino Acid Sequence: CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 29.2
• UniProt: P42971
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.