Penicillin-binding Protein 1A, Recombinant, Clostridium Botulinum, aa663-830, His-SUMO-Tag (PbpA)

Product Overview

• Article Name: Penicillin-binding Protein 1A, Recombinant, Clostridium Botulinum, aa663-830, His-SUMO-Tag (PbpA)
• Biozol Catalog Number: USB-370741
• Supplier Catalog Number: 370741
• Alternative Catalog Number: USB-370741-20,USB-370741-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). Source: Partial recombinant protein corresponding to aa663-830 from Clostridium botulinum PbpA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.2kD Amino Acid Sequence: VDRISGKLPTQLSYRDPRGSTVYNEFFINGTIPTEYDDIHVEAQINKLTGKLASKFTPSFLVESRVFLRRDYSPGVELLDQQWLLPYSIDEGGSLPPTEEKNNSNTRDKNKDKNKNKNKDKNPSQDKPNNNNNDNNSNNNNNNNDNNNNTKPPENDSNQNHEDNKNKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 35.2
• UniProt: A5I6G4
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.