Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-SUMO-Tag (PbpE)

Catalog Number: USB-370742
Article Name: Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-SUMO-Tag (PbpE)
Biozol Catalog Number: USB-370742
Supplier Catalog Number: 370742
Alternative Catalog Number: USB-370742-20,USB-370742-100,USB-370742-1
Manufacturer: US Biological
Category: Molekularbiologie
Probably involved in peptidoglycan modification during cortex synthesis. Full length recombinant protein corresponding to aa1-451 from Bacillus subtilis PbpE, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~67.4kD Amino Acid Sequence: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 67.4
UniProt: P32959
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.