Pollen allergen Phl p 5b, Recombinant, Phleum Pratense, aa20-284, His-SUMO-Tag

Product Overview

• Article Name: Pollen allergen Phl p 5b, Recombinant, Phleum Pratense, aa20-284, His-SUMO-Tag
• Biozol Catalog Number: USB-370752
• Supplier Catalog Number: 370752
• Alternative Catalog Number: USB-370752-20,USB-370752-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Has ribonuclease activity. May be involved in host-pathogen interactions. Source: Recombinant protein corresponding to aa20-284 from phleum pratense Pollen allergen Phl p 5b, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.11kD Amino Acid Sequence: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.11
• UniProt: Q40963
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.