PPIA, Recombinant, Escherichia coli, aa25-190, His-SUMO-Tag (Peptidyl-prolyl Cis-trans Isomerase A)

Catalog Number: USB-370755
Article Name: PPIA, Recombinant, Escherichia coli, aa25-190, His-SUMO-Tag (Peptidyl-prolyl Cis-trans Isomerase A)
Biozol Catalog Number: USB-370755
Supplier Catalog Number: 370755
Alternative Catalog Number: USB-370755-20,USB-370755-100
Manufacturer: US Biological
Category: Molekularbiologie
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Source: Recombinant protein corresponding to aa25-190 from Escherichia coli PPIA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.1kD Amino Acid Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.1
UniProt: P0AFL5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.