Protein YebF, Recombinant, Escherichia coli, aa22-118, His-Tag, Myc-Tag (YebF)

Catalog Number: USB-370764
Article Name: Protein YebF, Recombinant, Escherichia coli, aa22-118, His-Tag, Myc-Tag (YebF)
Biozol Catalog Number: USB-370764
Supplier Catalog Number: 370764
Alternative Catalog Number: USB-370764-20,USB-370764-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa22-118 from Escherichia coli Protein yebF, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~15.8kD Amino Acid Sequence: ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.8
UniProt: P33219
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.