Ubiquitin-like Protein SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (SMT3)
Biozol Catalog Number:
USB-370795
Supplier Catalog Number:
370795
Alternative Catalog Number:
USB-370795-20,USB-370795-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Not known, suppressor of MIF2 mutations. Source: Recombinant protein corresponding to aa2-98 from Saccharomyces cerevisiae SMT3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.12kD Amino Acid Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted