Sortilin, Recombinant, Rat, aa610-754, His-SUMO-Tag (Sort1)

Catalog Number: USB-370798
Article Name: Sortilin, Recombinant, Rat, aa610-754, His-SUMO-Tag (Sort1)
Biozol Catalog Number: USB-370798
Supplier Catalog Number: 370798
Alternative Catalog Number: USB-370798-20,USB-370798-100
Manufacturer: US Biological
Category: Molekularbiologie
Functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Required for protein transport from the Golgi apparatus to the lysosomes by a pathway that is independent of the mannose-6-phosphate receptor (M6PR). Also required for protein transport from the Golgi apparatus to the endosomes. Promotes neuronal apoptosis by mediating endocytosis of the proapoptotic precursor forms of BDNF (proBDNF) and NGFB (proNGFB). Also acts as a receptor for neurotensin. May promote mineralization of the Extracellular domain matrix during osteogenic differentiation by scavenging Extracellular domain LPL. Probably required in adipocytes for the formation of specialized storage vesicles containing the glucose transporter SLC2A4/GLUT4 (GLUT4 storage vesicles, or GSVs). These vesicles provide a stable pool of SLC2A4 and confer increased responsiveness to insulin. May also mediate transport from the endoplasmic reticulum to the Golgi. Source: Partial recombinant protein corresponding to aa610-754 from rat Sort1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.5kD Amino Acid Sequence: CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.5
UniProt: O54861
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.