Superoxide Dismutase [Cu-Zn], Recombinant, Danio Rerio, aa1-154, His-SUMO-Tag, Myc-Tag (Sod1)

Catalog Number: USB-370803
Article Name: Superoxide Dismutase [Cu-Zn], Recombinant, Danio Rerio, aa1-154, His-SUMO-Tag, Myc-Tag (Sod1)
Biozol Catalog Number: USB-370803
Supplier Catalog Number: 370803
Alternative Catalog Number: USB-370803-20,USB-370803-100
Manufacturer: US Biological
Category: Molekularbiologie
Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Source: Recombinant protein corresponding to aa1-154 from full length danio rerio Cu-Zn sod1, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~37.1kD Amino Acid Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGGRLACGVIGITQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.1
UniProt: O73872
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.