Recombination Protein UvsY, Recombinant, Enterobacteria Phage T4, aa1-137, His-SUMO-Tag (UvsY)
Biozol Catalog Number:
USB-370820
Supplier Catalog Number:
370820
Alternative Catalog Number:
USB-370820-20,USB-370820-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role in viral DNA synthesis by promoting enzymatic activities of UvsX recombinase, by promoting UvsX-ssDNA filament assembly, and by helping UvsX to displace bound gp32 from ssDNA. Source: Recombinant protein corresponding to aa1-137 from full length Enterobacteria phage T4 UvsY, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.83kD Amino Acid Sequence: MRLEDLQEELKKDVFIDSTKLQYEAANNVMLYSKWLNKHSSIKKEMLRIEAQKKVALKARLDYYSGRGDGDEFSMDRYEKSEMKTVLSADKDVLKVDTSLQYWGILLDFCSGALDAIKSRGFAIKHIQDMRAFEAGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted