VEGFA, Recombinant, Porcine, aa27-190, His-Tag (Vascular Endothelial Growth Factor A)
Biozol Catalog Number:
USB-370823
Supplier Catalog Number:
370823
Alternative Catalog Number:
USB-370823-20,USB-370823-100,USB-370823-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Recombinant protein corresponding to aa27-190 from porcine VEGFA, fused to His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P49151 Amino Acid Sequence: APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
