50S Ribosomal Protein L7/L12, Recombinant, Staphylococcus Aureus, aa1-122, His-SUMO-Tag (RplL)

Product Overview

• Article Name: 50S Ribosomal Protein L7/L12, Recombinant, Staphylococcus Aureus, aa1-122, His-SUMO-Tag (RplL)
• Biozol Catalog Number: USB-372092
• Supplier Catalog Number: 372092
• Alternative Catalog Number: USB-372092-20,USB-372092-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. Source: Recombinant protein corresponding to aa1-122 from staphylococcus aureus 50S Ribosomal Protein L7/L12, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.7kD Amino Acid Sequence: MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.7
• UniProt: P66061
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.