ABCB1, Recombinant, Human, aa236-297, His-Tag (Multidrug Resistance Protein 1)

Product Overview

• Article Name: ABCB1, Recombinant, Human, aa236-297, His-Tag (Multidrug Resistance Protein 1)
• Biozol Catalog Number: USB-372104
• Supplier Catalog Number: 372104
• Alternative Catalog Number: USB-372104-20,USB-372104-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. Recombinant protein corresponding to aa236-297 from human ABCB1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~10.8kD Amino Acid Sequence: LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 10.8
• UniProt: P08183
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.