Abhd11, Recombinant, Mouse, aa1-307, His-Tag (Alpha/beta hydrolase Domain-containing Protein 11)

Catalog Number: USB-372108
Article Name: Abhd11, Recombinant, Mouse, aa1-307, His-Tag (Alpha/beta hydrolase Domain-containing Protein 11)
Biozol Catalog Number: USB-372108
Supplier Catalog Number: 372108
Alternative Catalog Number: USB-372108-20,USB-372108-100
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-307 from mouse Abhd11, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~35.6kD Amino Acid Sequence: MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.6
UniProt: Q8K4F5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.