ABP1, Recombinant, Zea Mays, aa39-201, His-Tag (Auxin-binding Protein 1)

Catalog Number: USB-372113
Article Name: ABP1, Recombinant, Zea Mays, aa39-201, His-Tag (Auxin-binding Protein 1)
Biozol Catalog Number: USB-372113
Supplier Catalog Number: 372113
Alternative Catalog Number: USB-372113-20,USB-372113-100
Manufacturer: US Biological
Category: Molekularbiologie
This is probably a receptor for the plant hormone auxin. Source: Recombinant protein corresponding to aa39-201 from zea mays ERABP1, fused to 6XHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.4kD Amino Acid Sequence: SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.4
UniProt: P13689
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.