ACP1, Recombinant, Human, aa1-158, GST-Tag (Low Molecular Weight Phosphotyrosine Protein Phosphatase)

Catalog Number: USB-372126
Article Name: ACP1, Recombinant, Human, aa1-158, GST-Tag (Low Molecular Weight Phosphotyrosine Protein Phosphatase)
Biozol Catalog Number: USB-372126
Supplier Catalog Number: 372126
Alternative Catalog Number: USB-372126-20,USB-372126-100,USB-372126-1
Manufacturer: US Biological
Category: Molekularbiologie
Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity. Recombinant protein corresponding to aa1-158 from human ACP1, fused to GST-Tag at N-terminal, expressed in E. coli. Amino Acid Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 45
UniProt: P24666
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in PBS, pH 7.4, 50% glycerol.