Adk, Recombinant, E. coli, aa1-214, His-Tag (Adenylate Kinase)

Product Overview

• Article Name: Adk, Recombinant, E. coli, aa1-214, His-Tag (Adenylate Kinase)
• Biozol Catalog Number: USB-372161
• Supplier Catalog Number: 372161
• Alternative Catalog Number: USB-372161-20,USB-372161-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Source: Recombinant protein corresponding to aa1-214 from E. coli Adk, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.7kD Amino Acid Sequence: MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 27.7
• UniProt: P69441
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.