ADRB1, Recombinant, Human, aa378-477, His-Tag (Beta-1 Adrenergic Receptor)

Catalog Number: USB-372162
Article Name: ADRB1, Recombinant, Human, aa378-477, His-Tag (Beta-1 Adrenergic Receptor)
Biozol Catalog Number: USB-372162
Supplier Catalog Number: 372162
Alternative Catalog Number: USB-372162-20,USB-372162-100
Manufacturer: US Biological
Category: Molekularbiologie
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Source: Recombinant protein corresponding to aa378-477 from human ADRB1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.5kD Amino Acid Sequence: CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12.5
UniProt: P08588
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.