AFG3L2, Recombinant, Human, aa550-759, GST-Tag (AFG3-like Protein 2)

Product Overview

• Article Name: AFG3L2, Recombinant, Human, aa550-759, GST-Tag (AFG3-like Protein 2)
• Biozol Catalog Number: USB-372167
• Supplier Catalog Number: 372167
• Alternative Catalog Number: USB-372167-20,USB-372167-100,USB-372167-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

ATP-dependent protease which is essential for axonal development. Source: Recombinant protein corresponding to aa550-759 from human AFG3L2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.8kD Amino Acid Sequence: ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 50.8
• UniProt: Q9Y4W6
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.