AMELX, Recombinant, Human, aa17-191, His-SUMO-Tag (Amelogenin, X Isoform)

Product Overview

• Article Name: AMELX, Recombinant, Human, aa17-191, His-SUMO-Tag (Amelogenin, X Isoform)
• Biozol Catalog Number: USB-372242
• Supplier Catalog Number: 372242
• Alternative Catalog Number: USB-372242-20,USB-372242-100,USB-372242-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel. Source: Recombinant protein corresponding to aa17-191 from human AMELX, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~35.9kD Amino Acid Sequence: MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 35.9
• UniProt: Q99217
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.