Annexin A5, Recombinant, Cynops Pyrrhogaster, aa1-323, His-Tag

Catalog Number: USB-372261
Article Name: Annexin A5, Recombinant, Cynops Pyrrhogaster, aa1-323, His-Tag
Biozol Catalog Number: USB-372261
Supplier Catalog Number: 372261
Alternative Catalog Number: USB-372261-20,USB-372261-100
Manufacturer: US Biological
Category: Molekularbiologie
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Source: Recombinant protein corresponding to aa1-323 from cynops pyrrhogaster Annexin A5, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~37.98kD Amino Acid Sequence: MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.98
UniProt: P70075
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.