ANXA8L2, Recombinant, Human, aa1-181, GST-Tag (Annexin A8-like Protein 2)

Product Overview

• Article Name: ANXA8L2, Recombinant, Human, aa1-181, GST-Tag (Annexin A8-like Protein 2)
• Biozol Catalog Number: USB-372275
• Supplier Catalog Number: 372275
• Alternative Catalog Number: USB-372275-20, USB-372275-100, USB-372275-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus. Source: Recombinant protein corresponding to aa1-181 from human ANXA8L2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.5kD Amino Acid Sequence: GNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 47.5
• UniProt: P61204
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.