ANXA8L2, Recombinant, Human, aa1-276, GST-Tag (Annexin A8-like Protein 2)

Catalog Number: USB-372276
Article Name: ANXA8L2, Recombinant, Human, aa1-276, GST-Tag (Annexin A8-like Protein 2)
Biozol Catalog Number: USB-372276
Supplier Catalog Number: 372276
Alternative Catalog Number: USB-372276-20, USB-372276-100, USB-372276-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-276 from human ANXA8L2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~57.7kD Amino Acid Sequence: MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 57.7
UniProt: Q5VT79
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.