AP1S3, Recombinant, Human, aa1-104, GST-Tag (AP-1 Complex Subunit Sigma-3)

Catalog Number: USB-372279
Article Name: AP1S3, Recombinant, Human, aa1-104, GST-Tag (AP-1 Complex Subunit Sigma-3)
Biozol Catalog Number: USB-372279
Supplier Catalog Number: 372279
Alternative Catalog Number: USB-372279-20,USB-372279-100,USB-372279-1
Manufacturer: US Biological
Category: Molekularbiologie
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Involved in TLR3 trafficking. Source: Recombinant protein corresponding to aa1-104 from human AP1S3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~40kD Amino Acid Sequence: MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNTWPFARA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40
UniProt: Q96PC3
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.