APOB, Recombinant, Human, aa28-127, His-Tag (Apolipoprotein B-100)

Catalog Number: USB-372295
Article Name: APOB, Recombinant, Human, aa28-127, His-Tag (Apolipoprotein B-100)
Biozol Catalog Number: USB-372295
Supplier Catalog Number: 372295
Alternative Catalog Number: USB-372295-20,USB-372295-100
Manufacturer: US Biological
Category: Molekularbiologie
Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor. Source: Recombinant protein corresponding to aa28-127 from human APOB, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.2kD Amino Acid Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.2
UniProt: P04114
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.