Apolipoprotein C3, Recombinant, Human, aa21-99, His-SUMO-Tag (Apolipoprotein C-III, APOC3)

Catalog Number: USB-372300
Article Name: Apolipoprotein C3, Recombinant, Human, aa21-99, His-SUMO-Tag (Apolipoprotein C-III, APOC3)
Biozol Catalog Number: USB-372300
Supplier Catalog Number: 372300
Alternative Catalog Number: USB-372300-20, USB-372300-100, USB-372300-1
Manufacturer: US Biological
Category: Molekularbiologie
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion, Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. Source: Recombinant protein corresponding to aa21-99 from human APOC3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.8kD Amino Acid Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.8
UniProt: P02656
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.