APOC4, Recombinant, Human, aa27-127, His-Tag (Apolipoprotein C-IV)

Catalog Number: USB-372303
Article Name: APOC4, Recombinant, Human, aa27-127, His-Tag (Apolipoprotein C-IV)
Biozol Catalog Number: USB-372303
Supplier Catalog Number: 372303
Alternative Catalog Number: USB-372303-20,USB-372303-100
Manufacturer: US Biological
Category: Molekularbiologie
May participate in lipoprotein metabolism. Source: Recombinant protein corresponding to aa27-127 from human Apolipoprotein C-IV, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.8kD Amino Acid Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.8
UniProt: P55056
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.