ASAH2B, Recombinant, Human, aa1-165, His-Tag (Putative Inactive Neutral Ceramidase B)

Catalog Number: USB-372348
Article Name: ASAH2B, Recombinant, Human, aa1-165, His-Tag (Putative Inactive Neutral Ceramidase B)
Biozol Catalog Number: USB-372348
Supplier Catalog Number: 372348
Alternative Catalog Number: USB-372348-20,USB-372348-100,USB-372348-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa1-165 from human ASAH2B, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.11kD Amino Acid Sequence: MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.11
UniProt: P0C7U1
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.