ASB6, Recombinant, Human, aa1-197, HIs-SUMO-Tag (Ankyrin Repeat and SOCS Box Protein 6)
Biozol Catalog Number:
USB-372350
Supplier Catalog Number:
372350
Alternative Catalog Number:
USB-372350-20,USB-372350-100,USB-372350-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Source: Recombinant protein corresponding to aa1-197 from human ASB6, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.4kD Amino Acid Sequence: MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted