Asgr1, Recombinant, Mouse, aa61-284, GST-Tag (Asialoglycoprotein Receptor 1)

Catalog Number: USB-372354
Article Name: Asgr1, Recombinant, Mouse, aa61-284, GST-Tag (Asialoglycoprotein Receptor 1)
Biozol Catalog Number: USB-372354
Supplier Catalog Number: 372354
Alternative Catalog Number: USB-372354-20,USB-372354-100
Manufacturer: US Biological
Category: Molekularbiologie
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface. Source: Recombinant protein corresponding to aa61-284 from mouse Asgr1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.2kD Amino Acid Sequence: QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.2
UniProt: P34927
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.