ATOH1, Recombinant, Human, aa1-354, His-SUMO-Tag (Protein Atonal Homolog 1)

Catalog Number: USB-372370
Article Name: ATOH1, Recombinant, Human, aa1-354, His-SUMO-Tag (Protein Atonal Homolog 1)
Biozol Catalog Number: USB-372370
Supplier Catalog Number: 372370
Alternative Catalog Number: USB-372370-20,USB-372370-100,USB-372370-1
Manufacturer: US Biological
Category: Molekularbiologie
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription. Source: Recombinant protein corresponding to aa1-354 from human ATOH1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.2kD Amino Acid Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 54.2
UniProt: Q92858
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.